PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_35998
Common NameKK1_036690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 225aa    MW: 26560.7 Da    PI: 5.2586
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_35998genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.5e-16855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W +eEde+l + v++lG ++W++ a+  g++R++k+c++rw +yl
    C.cajan_35998  8 KGTWLQEEDEQLTNFVALLGERRWDSLAKLAGLRRSGKSCRLRWMNYL 55
                     799*******************************************97 PP

2Myb_DNA-binding56.65.8e-1862106248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g+++ eE++l+v++ +qlG++ W++Iar+++ gRt++++k++w+++l
    C.cajan_35998  62 GPFSGEEEKLIVQLQQQLGNK-WAKIARKLP-GRTDNEIKNYWRTHL 106
                      79999****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.494355IPR017930Myb domain
SuperFamilySSF466892.24E-276102IPR009057Homeodomain-like
SMARTSM007172.1E-13757IPR001005SANT/Myb domain
PfamPF002491.1E-14855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-20962IPR009057Homeodomain-like
CDDcd001678.61E-91055No hitNo description
PROSITE profilePS5129425.60556110IPR017930Myb domain
SMARTSM007177.9E-1760108IPR001005SANT/Myb domain
PfamPF002491.1E-1562106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2563109IPR009057Homeodomain-like
CDDcd001673.36E-1163106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MQGEHLRKGT WLQEEDEQLT NFVALLGERR WDSLAKLAGL RRSGKSCRLR WMNYLRPNLK  60
HGPFSGEEEK LIVQLQQQLG NKWAKIARKL PGRTDNEIKN YWRTHLRKRA PQVRQEGNFK  120
YKLEIETRDF NQKSIDMVSI TEKVCCEDSE WETKDSSIDT LPLSDWELRS SPYETRILDW  180
IMQNEFGEKE VEQDCNSTGT FNYSPQEFAE GCDSWDFSGS LWDLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-2661102105MYB PROTO-ONCOGENE PROTEIN
1msf_C4e-2661102105C-Myb DNA-Binding Domain
1mse_C4e-2661102105C-Myb DNA-Binding Domain
1h8a_C5e-26611025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618278.11e-121PREDICTED: transcription factor MYB48-like
TrEMBLA0A151RH921e-167A0A151RH92_CAJCA; Transcription factor MYB48
STRINGGLYMA10G06680.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.14e-55myb domain protein 27